PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009592355.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 439aa    MW: 49169.2 Da    PI: 6.652
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009592355.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.26.7e-17108153147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g WT eEd +l+++vkq+G + W+ Ia++m   R +kqc++rw+++
   XP_009592355.1 108 KGQWTDEEDRKLLRLVKQFGERKWAQIAEKMD-ARAGKQCRERWHNH 153
                      799*****************************.************98 PP

2Myb_DNA-binding56.37.1e-18160202145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++ W++eE++llv+ +kqlG++ W+ Ia++++ gRt +++k++w+
   XP_009592355.1 160 KDTWSEEEELLLVETHKQLGNK-WAEIAKRIP-GRTQNSIKNHWN 202
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.215103158IPR017930Myb domain
SMARTSM007173.6E-14107156IPR001005SANT/Myb domain
SuperFamilySSF466891.94E-28107201IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-25109161IPR009057Homeodomain-like
PfamPF139211.3E-18111170No hitNo description
CDDcd001672.18E-14111154No hitNo description
SMARTSM007172.3E-15159207IPR001005SANT/Myb domain
PROSITE profilePS5129418.902159209IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.9E-20162207IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
MESGSAFRPY QNLPKPSPPL TAIDKFLLSH ENDFYPFSGA NASSSSSSSH ANGISWPISL  60
PDPSFIEGFF LNEHENGLIE DAKTVQKNKR ESWKKAKEGN STKNYLVKGQ WTDEEDRKLL  120
RLVKQFGERK WAQIAEKMDA RAGKQCRERW HNHFHPDIKK DTWSEEEELL LVETHKQLGN  180
KWAEIAKRIP GRTQNSIKNH WNATKRRMNS RRNKKRKNQA DGGQKEGSNV LQDYIRSVYF  240
TDDSSPTASP FHGGGGDGSG GGSSTATTVV TPSNSTNTNA TPPYTDDDAL SLITHQTCDE  300
EMNFMQNLFG KNSLIQCDNK AIDHSKEAKE TQNLFDNNSS MISSAFNSFP LAKGNVGSYS  360
TASTEKVTDE VGNYMPDYNT KEVNQHYYCP DIYLSYLLDG SSYMMNQASG CSSGGNNKVE  420
VDLMEMVLSS QGTFNNTFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-421062072103C-Myb DNA-Binding Domain
1msf_C3e-421062072103C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1204215KRRMNSRRNKKR
2210216RRNKKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009592355.10.0PREDICTED: myb-like protein Q
TrEMBLK4CA421e-149K4CA42_SOLLC; Uncharacterized protein
STRINGSolyc06g076840.1.11e-148(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA48251941
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.16e-61myb domain protein 119